PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna26188.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 467aa    MW: 52106.4 Da    PI: 8.2889
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna26188.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB63.44.7e-202731485
                    NF-YB 14 srimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
                             ++i+k++lP + ++++da++++ ec +efi +++se+++ c re+++ti+++ +l al  lGf +y+e++ +
  mrna26188.1-v1.0-hybrid  2 TKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCSREEKRTIAPEHVLKALQVLGFSEYIEEVYA 73
                             68******************************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.1E-282122IPR009072Histone-fold
Gene3DG3DSA:1.10.20.105.1E-322120IPR009072Histone-fold
PfamPF008082.5E-17259IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PfamPF047594.1E-68293465IPR006460Protein of unknown function DUF617, plant
TIGRFAMsTIGR015704.4E-61293466IPR006460Protein of unknown function DUF617, plant
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLISSESNE VCSREEKRTI APEHVLKALQ  60
VLGFSEYIEE VYAAYEQHKI ETVHDVAKSV KWGNGAEMTE EQALAEQQRM FAEARARMNG  120
GATAPKQPDP DQRFSWGSSA RNKERINVET PHHHLSLNKR EETKLLSLSL LVFTLYSTPT  180
FFNNTASLPF IAFLSYATTP TPMAKSLQDS SSKRHFHWTN KVGNEDDHGH DDHALPSLPK  240
AVSDEEKRKD TPHKAIQLQR RKLQAAAISR LRSVLTAFGK NRGGLPLGLG SRVVGTLFGS  300
KKGHVHFALQ RDPNSHPAFL IELATPISGL VKEMASGLVR IALECDKEKE DQEKKKTMES  360
KSSKSGSAVR RLLEEPVWRT YCNGKKSGFA SRRECGPKEW KVLKAVEPIS MGAGVLPCGD  420
EGEDGELMYM RAKFERVVGS RDSEAFYMMN PDSNGAPELS IYLLRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B2e-26111521133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299248.10.0PREDICTED: protein MIZU-KUSSEI 1
TrEMBLM5WA731e-128M5WA73_PRUPE; Uncharacterized protein
STRINGPOPTR_0012s05480.11e-123(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.23e-75nuclear factor Y, subunit B13